General Information

  • ID:  hor005552
  • Uniprot ID:  Q63467
  • Protein name:  Trefoil factor 1
  • Gene name:  Tff1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  animal
  • Expression:  expressed abundantly in the stomach and only faintly in the duodenum, but not in other tissues including the distal small and large intestines.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0010039 response to iron ion; GO:0030154 cell differentiation; GO:0030277 maintenance of gastrointestinal epithelium; GO:0035902 response to immobilization stress; GO:0043434 response to peptide hormone
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QNQEETCAVIPRERINCGFPGVTAQQCKEKGCCFDDSVRGFPWCFRPLVIENQQEEECPF
  • Length:  60
  • Propeptide:  MEHKVTCVLAMVLMLALSSLAQNQEETCAVIPRERINCGFPGVTAQQCKEKGCCFDDSVRGFPWCFRPLVIENQQEEECPF
  • Signal peptide:  MEHKVTCVLAMVLMLALSSLA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-33; 17-32; 27-44
  • Structure ID:  AF-Q63467-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005552_AF2.pdbhor005552_ESM.pdb

Physical Information

Mass: 796434 Formula: C297H452N84O93S7
Absent amino acids: HMY Common amino acids: EC
pI: 4.27 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 16
Hydrophobicity: -59.67 Boman Index: -13499
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.67
Instability Index: 6422.5 Extinction Coefficient cystines: 5875
Absorbance 280nm: 99.58

Literature

  • PubMed ID:  8836141
  • Title:  cDNA cloning of rat pS2 peptide and expression of trefoil peptides in acetic acid-induced colitis